PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g033710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 227aa    MW: 26464.7 Da    PI: 5.7835
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g033710.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox535.6e-1766119356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t+ ql+ Lee F++++ +  +++  LA+klgL+ +qV vWFqNrR ++k
  Csa17g033710.1  66 KKRKLTPIQLRLLEESFKEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRVRYK 119
                     56699***********************************************99 PP

2HD-ZIP_I/II1123.8e-3666156292
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     kkr+l+  q++lLEesF+ee++Lep+rK  la++Lglqp qvavWFqnrR R+ktkqlE+dy++Lk++y +lk+e + L  ++++L+++++
  Csa17g033710.1  66 KKRKLTPIQLRLLEESFKEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRVRYKTKQLEHDYDSLKASYAKLKTEWDILYLQNQTLKNKVA 156
                     9**************************************************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-1848123IPR009057Homeodomain-like
PROSITE profilePS5007116.37461121IPR001356Homeobox domain
SMARTSM003894.7E-1664125IPR001356Homeobox domain
PfamPF000462.5E-1466119IPR001356Homeobox domain
CDDcd000862.82E-1466122No hitNo description
Gene3DG3DSA:1.10.10.604.7E-1868129IPR009057Homeodomain-like
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PfamPF021832.1E-13121163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MENSDTDSEV FFWFQNQSHG HKFPPSCFPS SAHSAYYGSS SMSNTETNTV DEEDVCESNM  60
KREITKKRKL TPIQLRLLEE SFKEEKRLEP DRKLWLAEKL GLQPSQVAVW FQNRRVRYKT  120
KQLEHDYDSL KASYAKLKTE WDILYLQNQT LKNKVALLKE KLQMQENPEP QSMEAKKLEK  180
EGSSVKSYNT QYSEEEEGLG NQYSFPELAV LVFYYDSTLT ASNLRL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRVRYKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0003481e-127AC000348.2 Genomic sequence for Arabidopsis thaliana BAC T7N9 from chromosome I, complete sequence.
GenBankCP0026841e-127CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010477777.11e-168PREDICTED: homeobox-leucine zipper protein ATHB-54-like
SwissprotP0CJ651e-138ATB54_ARATH; Homeobox-leucine zipper protein ATHB-54
TrEMBLR0IF281e-130R0IF28_9BRAS; Uncharacterized protein
STRINGAT1G27045.11e-135(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM159081314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27045.11e-128HD-ZIP family protein